Scaffold Ga0115192_106700

Overview

Basic Information

• Taxon OID: 3300008521
• Scaffold ID: Ga0115192_106700
• Source Dataset Name: Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 370425937 reassembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2317
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location

• Location Name: National Institutes of Health, USA
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047508	Metagenome	149	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0115192_1067002	F047508	GGAG	MLGHRLVEGCVKYPYLRCIGEYLRHSFDTEDVGWVVKRSKLCALMEHIYYLWGDTYALSKALCTVYKAVTNGIDLIEGLYEVLFFENVEDNLYAACVVRNVKVALDLLSFGVTEGDEGVVDPYALFVPRGQDLVVGELDEGELQGGAATVEDQDFHKVLYYMVRCELILSSP*