Basic Information | |
---|---|
Taxon OID | 3300008517 Open in IMG/M |
Scaffold ID | Ga0111034_1255297 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 175 cmbsf. Combined Assembly of Gp0128389 and Gp0131431 MM4PM4 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Aarhus University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1093 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Aarhus Bay Station M5, Denmark |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Aarhus Bay station M5 | |||||||
Coordinates | Lat. (o) | 56.10555 | Long. (o) | 10.463333 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F022812 | Metagenome / Metatranscriptome | 212 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0111034_12552972 | F022812 | AGG | MSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDL |
⦗Top⦘ |