Scaffold Ga0111034_1177662

Overview

Basic Information

• Taxon OID: 3300008517
• Scaffold ID: Ga0111034_1177662
• Source Dataset Name: Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 175 cmbsf. Combined Assembly of Gp0128389 and Gp0131431 MM4PM4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Aarhus University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 12577
• Total Scaffold Genes: 15
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Aarhus Bay Station M5, Denmark

Source Dataset Sampling Location

• Location Name: Aarhus Bay station M5
• Coordinates
  • Lat. (^o): 56.10555
  • Long. (^o): 10.463333

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098191	Metagenome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0111034_11776623	F098191	GAGG	MAEDKKETYDVRLLCRNCDHDWIEKVKRGIYIRYEKDNNYMINRGDSNKKRKFFTCPSCGAHKKIARFSTRGYRG*