NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0111033_1258662

Scaffold Ga0111033_1258662


Overview

Basic Information
Taxon OID3300008516 Open in IMG/M
Scaffold IDGa0111033_1258662 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf. Combined Assembly of MM3PM3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAarhus University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2746
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Aarhus Bay Station M5, Denmark

Source Dataset Sampling Location
Location NameAarhus Bay station M5
CoordinatesLat. (o)56.10555Long. (o)10.463333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F103051Metagenome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0111033_12586621F103051GAGGMQNIFKRPMFRKGGLSTTNRVGYSEAGSAIADAKELMEIENMRDPFLPFDMSEETKTVEEKFQRRGNEQLIRDTMAKMGIMDQFIKPKKDRRLANLALRFGSGLADPNLRGSFLQKVAQAGAGAVPGLIQETEAMDNSAAGIEALKMKRFMDIYDREELRDYERSLDEDGIDQQETAFIKNIGFAAESLFPGTDFADLVDDEKQRVMDFVNGTLGNDIQKRTEYLNDIYKITEASPKLSDYEDDFQGFDAAVASYDNKRRKKARSKQIHESLLASGKIEGIDISTVAIFDGTQGPVQENVLYEIAATMEDSKTGEKNI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.