Basic Information | |
---|---|
Taxon OID | 3300008482 Open in IMG/M |
Scaffold ID | Ga0115187_108206 Open in IMG/M |
Source Dataset Name | Human stool microbial communities from NIH, USA - visit 2, subject 159490532 reassembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1722 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | National Institutes of Health, USA | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F057001 | Metagenome | 137 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115187_1082061 | F057001 | AGG | MTSKDLNKVQSEVKKASEKTLTGAVKAWCQLFKSGKEVNEILKENDIKVDKDIVPALVSLAKDKEVVIQLCKDILPRINNTFCAYKEIEREYLDKLDQDKNVKMTVDKIESIAILGTTHKRFGYNEPVEYDGGVYYDVFNGSDKRIVKCAVPIKRYTYNLIAKCITYYLTHPKNER* |
⦗Top⦘ |