NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115371_10777073

Scaffold Ga0115371_10777073


Overview

Basic Information
Taxon OID3300008470 Open in IMG/M
Scaffold IDGa0115371_10777073 Open in IMG/M
Source Dataset NameSediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)641
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Sediment Core Microbial Communities From Adelie Basin, Antarctica

Source Dataset Sampling Location
Location NameAdelie Basin, Antarctica
CoordinatesLat. (o)-66.314Long. (o)140.425Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021804Metagenome / Metatranscriptome217Y
F058067Metagenome / Metatranscriptome135Y

Sequences

Protein IDFamilyRBSSequence
Ga0115371_107770731F058067N/AWDICGIERGKFITEGMFNKLAEGQRIDCRQHTFEKDGKEMLTYFQPSQTARKICVKHLNDAVDLNMLYTPEVLTENILKMIEPMVSAKFSYGDELEQDELADIITEKQ*
Ga0115371_107770732F021804N/AMMLPKTLNTAKLKVKYVLGNHTTIPSYPDYEDVLFELIRDYCGKVAKEIKFTNVSMAKRWSISQEQCSVILDKLLKEEFINISLQNSAYTTYEVIYNPYE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.