Scaffold Ga0115371_10656404

Overview

Basic Information

• Taxon OID: 3300008470
• Scaffold ID: Ga0115371_10656404
• Source Dataset Name: Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 553
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Sediment Core Microbial Communities From Adelie Basin, Antarctica

Source Dataset Sampling Location

• Location Name: Adelie Basin, Antarctica
• Coordinates
  • Lat. (^o): -66.314
  • Long. (^o): 140.425

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077199	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115371_106564042	F077199	N/A	VKQVQKKVVMSRKDIIKFQLLTHCYINKITVSDSDLECLTLLSSLGPIELTHFCYDAAEEHKIFKSQQTVRNCINKCVKNKLIKKNSSNKKLISINNNIKVETKGTIFLDYRFLGK*