Basic Information | |
---|---|
Taxon OID | 3300008416 Open in IMG/M |
Scaffold ID | Ga0115362_100021860 Open in IMG/M |
Source Dataset Name | Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC12B |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Shell Corporation |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1530 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gulf of Mexico | |||||||
Coordinates | Lat. (o) | 27.4 | Long. (o) | -93.2 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056171 | Metagenome / Metatranscriptome | 138 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115362_1000218604 | F056171 | N/A | MKKFTHKAIIAIIYATVIGLTIMAISGIGFLIFDLITGNLDADXGIYR* |
⦗Top⦘ |