Scaffold Ga0114885_10817

Overview

Basic Information

• Taxon OID: 3300008409
• Scaffold ID: Ga0114885_10817
• Source Dataset Name: Coastal sediment microbial communities from intertidal sand flat, Janssand, Germany_1868_binC
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Max Planck Institute for Plant Breeding Research
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 91003
• Total Scaffold Genes: 80
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 56 (70.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Sediment → Coastal Sediment Microbial Communities From Intertidal Sand Flat, Janssand, Germany

Source Dataset Sampling Location

• Location Name: Janssand, Germany
• Coordinates
  • Lat. (^o): 53.736
  • Long. (^o): 7.6989
  • Depth (m): .02

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059979	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114885_1081737	F059979	AGGAG	MKSFLFILAQLTLVTIVYAFAYRAGYREAQSKAMSVVKKFADPVTCLLDQLNESVEEAKKAEHEDEAKK*