Scaffold Ga0114364_1134283

Overview

Basic Information

• Taxon OID: 3300008267
• Scaffold ID: Ga0114364_1134283
• Source Dataset Name: Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Michigan
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 712
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location

• Location Name: Lake Erie, USA
• Coordinates
  • Lat. (^o): 41.7026
  • Long. (^o): -83.2538
  • Depth (m): 5.7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043935	Metagenome	155	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114364_11342831	F043935	AGAAG	MTNKELKILDNEIQYLCNHYQDRIKAIRQVTGINPAFTFLREVEIIESLYKSVLEHRKTEKATYFSCGTSGWHITYLRNKNTYKDGEKFVIKIYFSFVEADTYE*