Scaffold Ga0114363_1079537

Overview

Basic Information

• Taxon OID: 3300008266
• Scaffold ID: Ga0114363_1079537
• Source Dataset Name: Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Michigan
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1225
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location

• Location Name: Lake Erie, USA
• Coordinates
  • Lat. (^o): 41.7026
  • Long. (^o): -83.2538
  • Depth (m): 5.9

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095001	Metagenome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114363_10795371	F095001	GAG	MKAVIHMRGIYGGTFSQTKEFKDDKHLDNWLTWMDRNQDRVKVIGTTI