Basic Information | |
---|---|
Taxon OID | 3300008251 Open in IMG/M |
Scaffold ID | Ga0105359_10179114 Open in IMG/M |
Source Dataset Name | Methane-oxidizing microbial communities from mesocosms in the Gulf of Mexico - GOM8C Gulf of Mexico |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1123 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm → Methane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gulf of Mexico | |||||||
Coordinates | Lat. (o) | 27.37 | Long. (o) | -90.57 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F101886 | Metagenome / Metatranscriptome | 102 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0105359_101791142 | F101886 | N/A | LLANCATKYPLPYEIIYQVKKEEKTMLKKIAIIGFCLFNVVLFILIGIEVAAVTPERAMLEGVTQRIYASISTLDYIMAILWGVILYTILTVKKEHFLRASYLYLGFYLCDIHFSHYMSVEMNDPYFTPGALALVAIQIGFLFWAKNRINTANLALSN* |
⦗Top⦘ |