Basic Information | |
---|---|
Taxon OID | 3300008220 Open in IMG/M |
Scaffold ID | Ga0114910_1032479 Open in IMG/M |
Source Dataset Name | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1751 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mediterranean Sea | |||||||
Coordinates | Lat. (o) | 43.02 | Long. (o) | 8.37 | Alt. (m) | Depth (m) | 2641 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F007647 | Metagenome / Metatranscriptome | 347 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0114910_10324794 | F007647 | GAG | LDQAKINNVVNTFFTSLKADEDKMLETGLTNNATVEILRQAVLQLIQDNPKKFEQYIKFFEIACMYLQNETDEVPEIEKNE* |
⦗Top⦘ |