Scaffold Ga0114904_1018070

Overview

Basic Information

• Taxon OID: 3300008218
• Scaffold ID: Ga0114904_1018070
• Source Dataset Name: Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2123
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 39.48
  • Long. (^o): 5.24
  • Depth (m): 2820

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092205	Metagenome / Metatranscriptome	107	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0114904_10180706	F092205	GAGG	LEIFRERMVKKEEIILPKNKMYVIMSPIGEDQFNIICVDKMEKPINELYYMMRGLCEMSIKHQEDLIEVGKEVMLQEKLKTTKLELKSNIIPFRPRRGNGKKH*