NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114898_1005411

Scaffold Ga0114898_1005411


Overview

Basic Information
Taxon OID3300008216 Open in IMG/M
Scaffold IDGa0114898_1005411 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5652
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (44.44%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)38.55Long. (o)13.18Alt. (m)Depth (m)3511
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006550Metagenome / Metatranscriptome370N
F049699Metagenome / Metatranscriptome146N

Sequences

Protein IDFamilyRBSSequence
Ga0114898_10054113F006550GAGGMQGKINKREIDYKGQQLWLNPVDKTVYATDGAPTYSFGDVNGTPIYNFNAHFDAVKTAKDKLGTSYMHDAFVDPEFKSLAEDYVSDIKSGGRQRMAALRSNVNSAVDIVNVWETVLGKRDRVYAGKNLAKEIAVPNLLISIDTVTKFTGMEKLDEGMRARVKELPYTRSTFTAAKYGLKFIIHEEARLKNVHNVLQDSIQVASTKIEQRQSFDVLAITETNTAQAASAAWDTFVSSTDRSTGDPTVDIGIASLNIEGSGVGGKLTRVGMHQLTFAKFTGNTFLRGVASNGPRDYNYEPGTSELVGIPGIGLVLDNGIKQGDVHCVDTELEPNCALFQGPQRVGSQHDEETGDDKYFIIDYHLAAKIQSETGRLITGAITPLAW*
Ga0114898_10054118F049699N/AMSLDIAEQRLSSAKDRIRKYIDQNIMIWATEEVLLPGQSDIAASVSQRASQGLSLEKSGFMKVELVWNFRGDDNQPIHFYLEYGTKPHRIEAKGKMGGGADWLHWKGPSGGFVIGKDHFAKEVRHPGTEPKMLVHGIRDERIPALEKRIASEVQNHLEIDKT*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.