Scaffold Ga0114350_1081094

Overview

Basic Information

• Taxon OID: 3300008116
• Scaffold ID: Ga0114350_1081094
• Source Dataset Name: Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Michigan
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1076
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location

• Location Name: Lake Erie, USA
• Coordinates
  • Lat. (^o): 41.7635
  • Long. (^o): -83.3309
  • Depth (m): 4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002267	Metagenome / Metatranscriptome	576	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114350_10810942	F002267	N/A	MLWEFNMPITIGSGVEIGGGITIEQGFSTSVDLVYDLDAANYSAVPVNGSVTDGTGTTGQRTLTVANAGCSISWQSANGGVFRKSNAVGTDVIYGGPNWSTGQSYSVFATYKLSATSSGRLLNTQSEATRDWLLGAYNGFVNAFYPNYAVNLPSSGTNAAWNFIWGTWNASTGLGQLYTATNTQPVGTAFAVTNLGSGGGPNQIRLFSRSAGSEVQTGDIGFVKAYNGILTLADVQGLYTQYKSRFGY*