Scaffold Ga0105964_1000064

Overview

Basic Information

• Taxon OID: 3300008077
• Scaffold ID: Ga0105964_1000064
• Source Dataset Name: Human stool microbial communities from NIH, USA - visit 1, subject 763860675 reassembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 141727
• Total Scaffold Genes: 165
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 101 (61.21%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location

• Location Name: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013656	Metagenome	269	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105964_1000064144	F013656	AGGAG	MEKIYKEPNKSETETTINVLYSENMLSIYTNKVNLQKKLNKLLGTPTKEDKIKRSIAGSRWNISLDDKTKIQKIILKANIYEL*