NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0110938_1072155

Scaffold Ga0110938_1072155


Overview

Basic Information
Taxon OID3300008070 Open in IMG/M
Scaffold IDGa0110938_1072155 Open in IMG/M
Source Dataset NameWastewater microbial communities from the hospital sewers in Singapore - Hospital 2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1867
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From The Hospital Sewers

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.3Long. (o)103.8Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F101357Metagenome / Metatranscriptome102N
F105375Metagenome100N

Sequences

Protein IDFamilyRBSSequence
Ga0110938_10721551F101357AGGMNLNNITTALKTGITIYQYEQWQNTGSVNLMQKESHMLSKVWLKTNIHNPDSLDKPFIQLSATFTSEFDIQEYNEWLRANQYKLYPLLLDILKISLKDDYYNYSNTSNIHYEGGKFPSMLTIQLFNLEF*
Ga0110938_10721553F105375N/AMKNNETFQTTQHLDKLVTNLGLQIQELFSLDLEEILDYSNNLMNLLVNAYVENTCLALSAMISKQDGFAIYSFLFQTPDTSNGAADALVNFAMNFTDGEANIKSINRISSNIMQITFTV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.