Scaffold Ga0108970_10670521

Overview

Basic Information

• Taxon OID: 3300008055
• Scaffold ID: Ga0108970_10670521
• Source Dataset Name: Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1504
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary → Microbial Communities Of Marine Eelgrass

Source Dataset Sampling Location

• Location Name: Netarts Bay, Oregon, USA
• Coordinates
  • Lat. (^o): 45.394187
  • Long. (^o): -123.939629

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035276	Metagenome / Metatranscriptome	172	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0108970_106705212	F035276	N/A	MTCHISCYNQETRELEHFKVPKSVYVYVIQLECEIKYGRGGVQKLYPGRFNGKFFDEK*