Scaffold Ga0100405_1001726

Overview

Basic Information

• Taxon OID: 3300008045
• Scaffold ID: Ga0100405_1001726
• Source Dataset Name: Coral microbial communities from Puerto Morelos, Mexico - Orbicella 8 C B metatranscriptome (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 743
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location

• Location Name: Mexico:La Bocana,Puerto Morelos
• Coordinates
  • Lat. (^o): 20.8778
  • Long. (^o): -86.8431

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038079	Metagenome / Metatranscriptome	166	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0100405_10017262	F038079	N/A	TGPGKPGKSWNFIVAFSRTGKSWKKATGPGKFWKSVKLK*