NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102924_1228644

Scaffold Ga0102924_1228644


Overview

Basic Information
Taxon OID3300007982 Open in IMG/M
Scaffold IDGa0102924_1228644 Open in IMG/M
Source Dataset NameIron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)784
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameCanada: Banff, British Columbia
CoordinatesLat. (o)51.1699Long. (o)-116.1578Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026656Metagenome / Metatranscriptome197Y

Sequences

Protein IDFamilyRBSSequence
Ga0102924_12286441F026656AGGAGVPQAPARRDTSRSSDVAKLVTLHHRRRGWAWVAIGGVTGLVVYAGIDVNLFENLTGTAETLSVIPVFVLFALVLAGLVVVIIDTSRIRRADGAVRVSAKANVSHYPLYAHAHRYPPRHRGSWVFAILLLVAMTGITVFILPAEVNSWGYVVGAEHQDTFNPASYSQACSSGVGHRIGCHT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.