Scaffold Ga0105738_1048866

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0105738_1048866

Scaffold Ga0105738_1048866

Overview

Basic Information
Taxon OID	3300007953 Open in IMG/M
Scaffold ID	Ga0105738_1048866 Open in IMG/M
Source Dataset Name	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_3um
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Oregon State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	683
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water → Microbial Communities From Columbia River Estuary, Oregon, Usa

Source Dataset Sampling Location
Location Name	Oregon, USA
Coordinates	Lat. (^o)	46.234	Long. (^o)	-123.9163	Alt. (m)		Depth (m)	9.6
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007086	Metagenome / Metatranscriptome	358	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105738_10488662	F007086	AGGA	MNKKELYDIINEEISDAKFGVNHFLVTEELRESDKDEIRKIIRQEVSSIFFDLFKKRKSWGA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.