NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0111547_1003961

Scaffold Ga0111547_1003961


Overview

Basic Information
Taxon OID3300007908 Open in IMG/M
Scaffold IDGa0111547_1003961 Open in IMG/M
Source Dataset NameMicrobial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_686d_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Liverpool
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2368
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Anaerobic Oil Degrading Microbial Communities From River Tyne Estuarine Sediment

Source Dataset Sampling Location
Location NameUnited Kingdom
CoordinatesLat. (o)54.9632021Long. (o)-1.6348029Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002151Metagenome / Metatranscriptome589Y
F030418Metagenome185Y

Sequences

Protein IDFamilyRBSSequence
Ga0111547_10039611F030418N/AQNDPGLSQGFTGNMSIQPTNRDAGFFGDLGSTIGSFGSNVGQFFNDISPLTSLFGGGRSLPRTNSGTAISIDTGRPQETSQSGEILGASLGLAPALFQGARGLLRTPGGQTALGFGAGALGAAFAGNGSSAPRITRKMKSDVRRIYMMAGMDPAATAQILNNLGTYPRIDFNASVVFFILTKRFRNDGPVVTKAAVRKTKTTLRRMKNVADMYNSVCKPKPRSPRPRAAPKAVQLIKN*
Ga0111547_10039614F002151GGAMELSNYIALGCSIVAFALSVIACARIGKFSKATADTDWETLANLTGDIAALKRTCQTLNNRLNGMNKATIPQEQIIQQMLEHQNVEQIKRGG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.