Basic Information | |
---|---|
Taxon OID | 3300007906 Open in IMG/M |
Scaffold ID | Ga0111482_1020231 Open in IMG/M |
Source Dataset Name | Microbial communities from sediment of the River Tyne Estuary, UK ? Live_176d_1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Liverpool |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1338 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Anaerobic Oil Degrading Microbial Communities From River Tyne Estuarine Sediment |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | United Kingdom | |||||||
Coordinates | Lat. (o) | 54.9632021 | Long. (o) | -1.6348029 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013592 | Metagenome | 270 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0111482_10202311 | F013592 | GAGG | MLAPELVWLEEQLFEESQVPLRILSTFHPLVRIPIIAYTLADPIATELAQRTIEAGGVGAIDLFTPEIRRYEETALVGLGGMKI* |
⦗Top⦘ |