NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0111482_1006431

Scaffold Ga0111482_1006431


Overview

Basic Information
Taxon OID3300007906 Open in IMG/M
Scaffold IDGa0111482_1006431 Open in IMG/M
Source Dataset NameMicrobial communities from sediment of the River Tyne Estuary, UK ? Live_176d_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Liverpool
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2370
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Anaerobic Oil Degrading Microbial Communities From River Tyne Estuarine Sediment

Source Dataset Sampling Location
Location NameUnited Kingdom
CoordinatesLat. (o)54.9632021Long. (o)-1.6348029Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002151Metagenome / Metatranscriptome589Y
F030418Metagenome185Y

Sequences

Protein IDFamilyRBSSequence
Ga0111482_10064311F002151N/ANVDNYCMEYVNFIALGCSIAAFALSLIACARVGKFVRSTADTDWETLANLTGDIAALKRTCQTLNNRLNGMNKATIPQDQIIQQMLEHQNVEQIRRGG*
Ga0111482_10064312F030418GGCGGMGFFDALHTVVERVVPTAVGFVTGGPAGAVTSLAGVEQAKRTEKAIERAEYMYQQDPGLSQGFSGYQPSMASAGSGSFFGNLGQSIGSFGRDVGGFVSDIAPALNLFGYGGQAQRTNAGTAMTVDVGRPQETAQSGEVLGANLGLAPMLFQGARGLLRTPGGQTALGFGAGAAGALLAGDGQIAPRITRKMKSDVRRIYMMAGMDPNVTAQILNNMGTYPRMNFNASLVFFILTKRFRNDGPVVTKAAVRKTKTTLRRMKGVVDMYNSVCKPTSRRAPVRRTKTSTATTLIKN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.