Scaffold Ga0111098_10053

Overview

Basic Information

• Taxon OID: 3300007885
• Scaffold ID: Ga0111098_10053
• Source Dataset Name: Spring water viral communities from Black Pool hot spring in the West Thumb Geyser Basin, Yellowstone National Park, WY, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Roche Applied Science
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3816
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Planktonic → Spring Water Viral Communities From Black Pool Hot Spring In The West Thumb Geyser Basin, Yellowstone National Park, Wy, Usa

Source Dataset Sampling Location

• Location Name: Yellowstone National Park
• Coordinates
  • Lat. (^o): 44.41822
  • Long. (^o): -110.57182

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040513	Metagenome / Metatranscriptome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0111098_100538	F040513	GGTGG	MHALLSFLDYLVSELEYSYYLKKADSLCDYLDYLDAVVSLNEIRASEEYRMLCK*