NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0111032_1096666

Scaffold Ga0111032_1096666


Overview

Basic Information
Taxon OID3300007871 Open in IMG/M
Scaffold IDGa0111032_1096666 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf. Combined Assembly of MM2PM2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAarhus University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3182
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Aarhus Bay Station M5, Denmark

Source Dataset Sampling Location
Location NameAarhus Bay station M5
CoordinatesLat. (o)56.10555Long. (o)10.463333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038478Metagenome / Metatranscriptome166Y

Sequences

Protein IDFamilyRBSSequence
Ga0111032_10966662F038478AGGAGGVDETLQTKHPDLTAKLIDFDFGPNKIQIQATIFKELLEIDEEKAIKAFEELCRSFSEVCCEYHIKFDPIDLFILVDEELQIGTSTKFRDAYDESLFAEVLIPAKDFRMHEYWKYSFLHELGHSWFSVDFSPDDMECGHEDLFIDLVVICTFRKILPPDKRVYQEVRKHRPYFLTQQSKRFIGKELYKQILRDPEGYLRDLQQKIYSTHT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.