Basic Information | |
---|---|
Taxon OID | 3300007871 Open in IMG/M |
Scaffold ID | Ga0111032_1023264 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf. Combined Assembly of MM2PM2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Aarhus University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2360 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Aarhus Bay Station M5, Denmark |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Aarhus Bay station M5 | |||||||
Coordinates | Lat. (o) | 56.10555 | Long. (o) | 10.463333 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F083391 | Metagenome | 113 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0111032_10232643 | F083391 | AGGCGG | MKRTGRILTLSNDINNITPPSSISGNAFTLATIFEDDRENFGWKIIDVKQLAPISLTSRPTNWALMSVRPDSFVDGTVFGNWAVNRQTFDNSLIATFNNGIGDPYSLRTEHVATNHLSMFFNDGEIPYYNITLEEYQISSEEEIMLKIKETSQSLNDIGE* |
⦗Top⦘ |