Scaffold Ga0104322_113761

Overview

Basic Information

• Taxon OID: 3300007819
• Scaffold ID: Ga0104322_113761
• Source Dataset Name: Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Princeton University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1157
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil → Permafrost Core Soil Microbial Communities From Svalbard, Norway

Source Dataset Sampling Location

• Location Name: Svalbard, Norway
• Coordinates
  • Lat. (^o): 78.11096
  • Long. (^o): 15.55294

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017680	Metagenome / Metatranscriptome	239	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0104322_1137612	F017680	GAGG	MDNHEATFYSLQLRLVGGVSGDPAGHKVELIALPEGPGEPRPAHFEHWEPLSHRLSAVASSTPFHLKVMYRTLHAGLTAFLIDRATGHRQIFSHHQLKDLGLAS*