NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105109_1004491

Scaffold Ga0105109_1004491


Overview

Basic Information
Taxon OID3300007812 Open in IMG/M
Scaffold IDGa0105109_1004491 Open in IMG/M
Source Dataset NameExtremophilic microbial mat communities from Yellowstone National Park, USA - BED_Mat_host_6_15
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1428
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, USA
CoordinatesLat. (o)44.7315Long. (o)-110.7113Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F085906Metagenome / Metatranscriptome111N

Sequences

Protein IDFamilyRBSSequence
Ga0105109_10044911F085906N/AMSESLILDNLTSFLENFKGEFQSQVMQIGDGIYEEIGMLKVYLPGEDGGRVMGEYNVHAVIYDVVQVIRLDGRYYDMSDDRWHTVSLLLVFKYNELLDETFLQVG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.