Scaffold Ga0105679_10393868

Overview

Basic Information

• Taxon OID: 3300007790
• Scaffold ID: Ga0105679_10393868
• Source Dataset Name: Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Norwegian Sequencing Centre (NSC)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1129
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Desert → Soil → Zebra Blood And Desert Soils. Microbial Community Dynamics Using Metagenomics And Cultivation

Source Dataset Sampling Location

• Location Name: Etosha National Park, Namibia
• Coordinates
  • Lat. (^o): -19.03133
  • Long. (^o): 15.54865

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029479	Metagenome / Metatranscriptome	188	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105679_103938681	F029479	GAGG	MSKKPTGVAAGNSEALRIYERVEEERQRKEQARAEAKKPKKVTLPRLKFLEDK*