Scaffold Ga0105711_1397816

Overview

Basic Information

• Taxon OID: 3300007777
• Scaffold ID: Ga0105711_1397816
• Source Dataset Name: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS918_NRZ_DNA CLC_assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 819
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location

• Location Name: North Rift Zone, Axial Seamount, northeast Pacific Ocean
• Coordinates
  • Lat. (^o): 46.0747
  • Long. (^o): -129.995
  • Depth (m): 1716

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076174	Metagenome / Metatranscriptome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105711_13978161	F076174	GGAG	MTVIMPKVEKLLIMTPDQKAVISEHTAEELEECRLSIQGTSNIIQYVFKKVEDDE*