Basic Information | |
---|---|
Taxon OID | 3300007756 Open in IMG/M |
Scaffold ID | Ga0105664_1220926 Open in IMG/M |
Source Dataset Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDBack_2015_DNA CLC_assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 528 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Northeast Pacific Ocean | |||||||
Coordinates | Lat. (o) | 45.9372 | Long. (o) | -130.082 | Alt. (m) | Depth (m) | 1500 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F099410 | Metagenome | 103 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0105664_12209261 | F099410 | AGGA | MGNQKKLYDNPKDAAKDLFTIGGAAIINKTLQTPIKKGKEKAAKWVEMAPGGGQVLETAKKLKDKGFYAEVDPFEK* |
⦗Top⦘ |