Scaffold Ga0104326_132109

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0104326_132109

Scaffold Ga0104326_132109

Overview

Basic Information
Taxon OID	3300007740 Open in IMG/M
Scaffold ID	Ga0104326_132109 Open in IMG/M
Source Dataset Name	Permafrost core soil microbial communities from Svalbard, Norway - sample 2-9-2 Soapdenovo
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Princeton University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3365
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Permafrost Core Soil Microbial Communities From Svalbard, Norway

Source Dataset Sampling Location
Location Name	svalbard,norway
Coordinates	Lat. (^o)	78.11096	Long. (^o)	15.55294	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006026	Metagenome / Metatranscriptome	383	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0104326_1321093	F006026	N/A	VSRLPPALAASATPRILEELGEPPARVLELGFAGIHAPLLRLAGFEVVVVEPDRAYRARARERAGDVLDQPPEEPFDAVIAPDGTDITGVTARKQVRVGQDGSVWSSA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.