Scaffold Ga0104986_1081

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0104986_1081

Scaffold Ga0104986_1081

Overview

Basic Information
Taxon OID	3300007734 Open in IMG/M
Scaffold ID	Ga0104986_1081 Open in IMG/M
Source Dataset Name	Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chunlab, Inc
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	10608
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (45.45%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Viral Communities From Lake Soyang, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location Name	Gangwon-do, South Korea
Coordinates	Lat. (^o)	37.953056	Long. (^o)	127.81721	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008938	Metagenome	325	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0104986_10812	F008938	GAG	MVKAGMPLTSEADASRWRLINQKKPSRVRPILKPSANSSEPSDPSEFVESIKSETTNGRLIRARRAELVAYSLVGRAYRDGSPVALRAAIQGWGEAKKRVSEAEVEHAQFEELTKATMRTSEVQEIYTKFLGQIRSLLDALPASLATRANPSDPECAKTAIQEGIDQIFIAIQKAEEGFK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.