Scaffold Ga0102932_1075450

Overview

Basic Information

• Taxon OID: 3300007626
• Scaffold ID: Ga0102932_1075450
• Source Dataset Name: Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_C_D2_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1306
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Source Dataset Sampling Location

• Location Name: South San Francisco, USA
• Coordinates
  • Lat. (^o): 37.4971
  • Long. (^o): -122.133
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015275	Metagenome / Metatranscriptome	256	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102932_10754503	F015275	AGGAG	MKSEFGFIDPGAIMGVVVSLIILAVGVFAFFVTISEIPTDGDTTTAAAVNNVSDTGNSVFNIIGIVLIIGAIMSIVGLVYNYVR*