NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102800_1023209

Scaffold Ga0102800_1023209


Overview

Basic Information
Taxon OID3300007608 Open in IMG/M
Scaffold IDGa0102800_1023209 Open in IMG/M
Source Dataset NameMarine microbial communities from the Southern Atlantic ocean - KN S19 Surf_B metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1277
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic Ocean
CoordinatesLat. (o)-28.2362Long. (o)-38.4949Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001026Metagenome / Metatranscriptome802Y
F007756Metagenome / Metatranscriptome345Y
F015105Metagenome / Metatranscriptome257Y

Sequences

Protein IDFamilyRBSSequence
Ga0102800_10232093F007756AGGAGGMNTLKRFYVNVKFEKYGTYTIEARSKEHALEIYNDGDYGWSDYSEDFGEFNEVVEDVEEEVFADTQLSLAGVF*
Ga0102800_10232094F001026GGGGGMAIHTLKLDDLELTALITHLEGQSEMMVESRLNCSNPSEIPDREEVLLNMVYSKAFTIGWEADKNPKVDFNLIQNQDRIYKYK*
Ga0102800_10232095F015105AGGAMNLEQRKANLIYEIASLINDDPLSAPILIEELVEVMFDEQIDQIEDVIVN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.