Basic Information | |
---|---|
Taxon OID | 3300007570 Open in IMG/M |
Scaffold ID | Ga0101524_1062520 Open in IMG/M |
Source Dataset Name | Marine sponge C. singaporensis microbiome, Papua New Guinea CO2 seep, Dobu 'bubble', co11ds |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of New South Wales |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 563 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Coelocarteria Singaporensis (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Papua New Guinea | |||||||
Coordinates | Lat. (o) | -9.73665 | Long. (o) | 150.867667 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F085224 | Metagenome | 111 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0101524_10625202 | F085224 | N/A | MGVPMFYPSKSLLKRWDESYGMMFQRTSGYGRRSAGGFSNIAYGKDLMPDPNDGVNRESLHYWLDKAEFYNWDVRYFDSPADLHEQLKAADFEAMHRDVLKTRARMDKIRDERWAEIRRDLTKTA* |
⦗Top⦘ |