NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102828_1005186

Scaffold Ga0102828_1005186


Overview

Basic Information
Taxon OID3300007559 Open in IMG/M
Scaffold IDGa0102828_1005186 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2531
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.2Long. (o)-123.94Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003308Metagenome / Metatranscriptome494Y
F006789Metagenome / Metatranscriptome364Y
F033422Metagenome / Metatranscriptome177Y

Sequences

Protein IDFamilyRBSSequence
Ga0102828_10051864F006789GGAGMALTDEDKAFLIKIGQELPKEVKETKQKAAPVETTTTETEV*
Ga0102828_10051865F033422N/AMTVPMFSNEGNLQGIEDTIVAVFGLLAASSIVFNVTAVSAPSVLALPSGDLLTSDLQISVLTSWS*
Ga0102828_10051866F003308N/AVMIANPGLFTTGQTVTVAGAGSTFAGTYTITSTLPFSSGSTSLLPAFNLQLNYYQYPQGYSFIQYAKTASDQNFRRVVPSGTMTGEDTKTASYANTPAINAAALMIAENIWTSRFSTQAGGVSVDGFSPSPFKMSNTLMASVRGLLAPYLNPSAMVG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.