Scaffold Ga0099847_1238868

Overview

Basic Information

• Taxon OID: 3300007540
• Scaffold ID: Ga0099847_1238868
• Source Dataset Name: Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 524
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location

• Location Name: USA: Chesapeake Bay
• Coordinates
  • Lat. (^o): 37.1
  • Long. (^o): -76.0972

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035744	Metagenome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0099847_12388683	F035744	AGCAG	MNNTINFTDLEKQKLIERISHVLNYTGAYKELHKLLVDREEVLLHSEMESLADDLEE