NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105016_1079712

Scaffold Ga0105016_1079712


Overview

Basic Information
Taxon OID3300007512 Open in IMG/M
Scaffold IDGa0105016_1079712 Open in IMG/M
Source Dataset NameMarine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um, replicate b
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBigelow Laboratory Single Cell Genomics Center (SCGC)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2042
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location NameCariaco Basin, Venezuela
CoordinatesLat. (o)10.5Long. (o)-64.66Alt. (m)Depth (m)247
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033590Metagenome / Metatranscriptome177Y
F033600Metagenome / Metatranscriptome177Y

Sequences

Protein IDFamilyRBSSequence
Ga0105016_10797122F033590N/AMGKFENRFLSLLKEEPVPAVDAEPADDAQSFAGSLDEPENAGDFEDIQDNQPNTANELSQLQEWIDNIDEVVDYLNGGTDSVLGYLRTDNKTGTIFDGVSDATKAEVLDVCERLASLNQIFKNLYIEKHK*
Ga0105016_10797123F033600N/AMMKGILFEDLYMYTNKYWKDVKSRHVRPTTKTLADIAKASPETYNKVKADLVPFPGDHAVEQLGSAFKSISDATYLLNQLFENPIVNSDEKTKSSVNNKLQKIQDLIKSVTDDLDHDGANNS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.