Scaffold Ga0105000_1010040

Overview

Basic Information

• Taxon OID: 3300007511
• Scaffold ID: Ga0105000_1010040
• Source Dataset Name: Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um, replicate b
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Genomics Facility
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 16019
• Total Scaffold Genes: 26
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 17 (65.38%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location

• Location Name: Cariaco Basin, Venezuela
• Coordinates
  • Lat. (^o): 10.5
  • Long. (^o): -64.66
  • Depth (m): 267

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034407	Metagenome / Metatranscriptome	175	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105000_10100406	F034407	AGG	MWDWAHFKDEGWLAHTKRSARLAVLLLASGVAMVLHLLVPFWQQPKRLQREEVACALCEGLESRKE*