Scaffold Ga0105011_1015696

Overview

Basic Information

• Taxon OID: 3300007508
• Scaffold ID: Ga0105011_1015696
• Source Dataset Name: Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um, replicate a
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Genomics Facility
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4657
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location

• Location Name: Cariaco Basin, Venezuela
• Coordinates
  • Lat. (^o): 10.5
  • Long. (^o): -64.66
  • Depth (m): 237

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088865	Metagenome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105011_101569612	F088865	N/A	MTRTFKRYEFKTFQALEKFFVNKILPQKNISTKVIGKVLLVWKKRKAA*