Scaffold Ga0104761_1066418

Overview

Basic Information

• Taxon OID: 3300007354
• Scaffold ID: Ga0104761_1066418
• Source Dataset Name: Deep subsurface aquifer microbial community from Lead, South Dakota (SURF_DUSEL_B)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: National Aeronautics and Space Administration (NASA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 807
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → unclassified Peptococcaceae → Peptococcaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Aquifer → Sanford Underground Research Facility - Surf_Dusel_B

Source Dataset Sampling Location

• Location Name: Lead, South Dakota, USA
• Coordinates
  • Lat. (^o): -44.0341666
  • Long. (^o): -103.765833

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021446	Metagenome / Metatranscriptome	219	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0104761_10664182	F021446	AGGAGG	MKTLSIALMAAFMLVLAATSTGQAQNAEYRDLDPTVGGKYIYRGADYIAQTLIVRGDKLSEINELTLIIQIKGSPDFRVTFPLLAKRQEGNKLILDYQWYPGGDTYEATIIGGTLINRKTKGYLAGIREELFIRE*