Scaffold Ga0104751_1102241

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0104751_1102241

Scaffold Ga0104751_1102241

Overview

Basic Information
Taxon OID	3300007351 Open in IMG/M
Scaffold ID	Ga0104751_1102241 Open in IMG/M
Source Dataset Name	Combined Assembly of Gp0115775, Gp0115815
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	National Aeronautics and Space Administration (NASA)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1151
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Deep Subsurface Aquifer → Sanford Underground Research Facility - Deep Subsurface Aquifer Microbial Community From Lead, South Dakota

Source Dataset Sampling Location
Location Name	Lead, South Dakota, USA
Coordinates	Lat. (^o)	44.03416667	Long. (^o)	-103.76583333	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021446	Metagenome / Metatranscriptome	219	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0104751_11022412	F021446	AGGAGG	MKTLSIALMAAFMLVLAATSTGQAQNAEYRDLDPTVGGKYIYRGADYIAQTLIVRGDKLSEINELTLIIEIKGNADVRLTFPLLAKRQEGNKLILDYEWYPGSDTYEATIIGGTLTNVKTKGWLVGREELFIRE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.