Scaffold Ga0079228_1408027

Overview

Basic Information

• Taxon OID: 3300007341
• Scaffold ID: Ga0079228_1408027
• Source Dataset Name: Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S2 Surf_B metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1619
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Southern Atlantic ocean
• Coordinates
  • Lat. (^o): -28.2362
  • Long. (^o): -38.4949

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021321	Metagenome / Metatranscriptome	219	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079228_14080271	F021321	GGAG	MNRDYMANMLFNINDVVETIKGHSINVDIIEEYDESQFETFPKTLMDIPKDWEGSTITIGDCLLDLQTHINELYDYFSSDDDTFIDINNTGGKY*