NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0099777_1381805

Scaffold Ga0099777_1381805


Overview

Basic Information
Taxon OID3300007324 Open in IMG/M
Scaffold IDGa0099777_1381805 Open in IMG/M
Source Dataset NameActive sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_C4L_LD (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)500
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Active Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria

Source Dataset Sampling Location
Location NameAustria: Klosterneuburg
CoordinatesLat. (o)48.3Long. (o)16.2Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082715Metagenome / Metatranscriptome113N

Sequences

Protein IDFamilyRBSSequence
Ga0099777_13818051F082715N/AMKFMKRSLSLLISAMLLLACFALAEETPLLPIAIVSYDLTDEATTAALSALIEPKENALTRWERVVLSDGREAWVICQFDQTTMSNAWSRVIDAETQEVLQEDTTDTGFFATAQTRWESAKGIYALWSIQDKMLFDRLYAMAPCYGEPVEGDLI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.