Scaffold Ga0099791_10040037

Overview

Basic Information

• Taxon OID: 3300007255
• Scaffold ID: Ga0099791_10040037
• Source Dataset Name: Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2079
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location

• Location Name: Eel River Critical Zone Observatory, California, USA
• Coordinates
  • Lat. (^o): 39.7291
  • Long. (^o): -123.6419

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007671	Metagenome / Metatranscriptome	347	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0099791_100400372	F007671	GAG	MVGQLGYTEADLRRLQEMVGAVPLLAPGDIRHVIDGCQYLDDWRANYRIQSVRSSLQSARITCIDAAILSYGLLELLFSGTKRRLLAIHRRDPKKDEECGHCVTLYWENDGRVGAISKSSFKGLGHREPVFADEASVAASYARAYLEMGFQPLYFGVTTLEEAAPDLDWRFHQGDLNEISGRLQAAYAYGFVVDY*