Basic Information | |
---|---|
Taxon OID | 3300007238 Open in IMG/M |
Scaffold ID | Ga0080112_1058769 Open in IMG/M |
Source Dataset Name | Non-marine hypersaline water viral communities from Salar Uyuni, Bolivia - ZN24 UYUNI 14 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Alicante |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 515 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Viral Communities From Salar Of Uyuni 2014 (Chile) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Salar Uyuni Bolivia | |||||||
Coordinates | Lat. (o) | -20.333333 | Long. (o) | -67.7 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F079661 | Metagenome | 115 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0080112_10587691 | F079661 | N/A | MDRTTIEIPSELRDKLKAERKPHESNYGDTIERLLNDGSGGQLWTKREIQDLVQREIEEHTRR* |
⦗Top⦘ |