Scaffold Ga0080112_1058769

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0080112_1058769

Scaffold Ga0080112_1058769

Overview

Basic Information
Taxon OID	3300007238 Open in IMG/M
Scaffold ID	Ga0080112_1058769 Open in IMG/M
Source Dataset Name	Non-marine hypersaline water viral communities from Salar Uyuni, Bolivia - ZN24 UYUNI 14
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Alicante
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	515
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Viral Communities From Salar Of Uyuni 2014 (Chile)

Source Dataset Sampling Location
Location Name	Salar Uyuni Bolivia
Coordinates	Lat. (^o)	-20.333333	Long. (^o)	-67.7	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079661	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0080112_10587691	F079661	N/A	MDRTTIEIPSELRDKLKAERKPHESNYGDTIERLLNDGSGGQLWTKREIQDLVQREIEEHTRR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.