Scaffold Ga0075183_11410450

Overview

Basic Information

• Taxon OID: 3300007232
• Scaffold ID: Ga0075183_11410450
• Source Dataset Name: Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A2 RNA (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 504
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent → Wastewater Effluent Complex Algal Communities From Wisconsin, To Seasonally Profile Nutrient Transformation And Carbon Sequestration

Source Dataset Sampling Location

• Location Name: Milwaukee, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.023
  • Long. (^o): -87.895
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078624	Metagenome / Metatranscriptome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0075183_114104502	F078624	N/A	MKLCIHVRPRDDKQGWAVDVFDGRRAWAKTHLGEQPLNKAEAHRLAHKLRDPKFYTARTKRAVNSLTVERGPKAVPHE*